PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK10271.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 165aa    MW: 19172.7 Da    PI: 8.0127
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK10271.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM68.32.2e-2135280129
        NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                +g+Wkatg+dk++++++++ +g++ktLvfy+grap+g+ktdW+mheyrle
  PK10271.2   3 AGFWKATGRDKAIHVSDTKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLE 52 
                79**********************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100529.859178IPR003441NAC domain
PfamPF023656.3E-10351IPR003441NAC domain
SuperFamilySSF1019411.83E-25378IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
XAAGFWKATG RDKAIHVSDT KRIGMRKTLV FYTGRAPHGQ KTDWIMHEYR LEDNDTTTAA  60
PADQIQEDGW VVCRVFKKKN HNRSFQPELG NNNNNNQEEL SYHPQMKTSI NGNSTPLVLD  120
HHHHQHLHHQ HHQPKHFQQL YDNYTFDHHG SMQLPQLFSP ESGAX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B7e-2028094167NAC domain-containing protein 19
4dul_A7e-2028094167NAC domain-containing protein 19
1ut7_B7e-2028094167NO APICAL MERISTEM PROTEIN
1ut7_A7e-2028094167NO APICAL MERISTEM PROTEIN
1ut4_B7e-2028094167NO APICAL MERISTEM PROTEIN
1ut4_A7e-2028094167NO APICAL MERISTEM PROTEIN
3swp_D8e-2028097170NAC domain-containing protein 19
3swp_C8e-2028097170NAC domain-containing protein 19
3swp_B8e-2028097170NAC domain-containing protein 19
3swp_A8e-2028097170NAC domain-containing protein 19
3swm_D8e-2028097170NAC domain-containing protein 19
3swm_C8e-2028097170NAC domain-containing protein 19
3swm_B8e-2028097170NAC domain-containing protein 19
3swm_A8e-2028097170NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150408e-33AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009368592.12e-61PREDICTED: protein SOMBRERO-like
SwissprotQ9MA172e-44SMB_ARATH; Protein SOMBRERO
TrEMBLM5WZ814e-61M5WZ81_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s18420.12e-53(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72043447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.32e-43NAC family protein